PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000288192
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HB-other
Protein Properties Length: 2257aa    MW: 253196 Da    PI: 5.8862
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000288192genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.93.4e-18440495257
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
       Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                     kR+  t+ qle+Le++++ + yps++ r+eL+++lgL++rq ++WF+ rR k+kk
  MDP0000288192 440 PKRQMKTPFQLETLEKAYALDTYPSEAVRAELSERLGLSDRQLQMWFCHRRLKDKK 495
                    69****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR008171.8E-127139436IPR004696Triose phosphate/phosphoenolpyruvate translocator
PfamPF031513.2E-107140426IPR004853Sugar phosphate transporter domain
SuperFamilySSF1034817.72E-5183275No hitNo description
SuperFamilySSF1034819.55E-5357427No hitNo description
Gene3DG3DSA:1.10.10.602.2E-17431496IPR009057Homeodomain-like
SuperFamilySSF466892.61E-16432496IPR009057Homeodomain-like
PROSITE profilePS5007117.006436496IPR001356Homeobox domain
SMARTSM003892.7E-18438500IPR001356Homeobox domain
PfamPF000467.4E-16440495IPR001356Homeobox domain
CDDcd000866.94E-15441496No hitNo description
SMARTSM005714.8E-2210161075IPR018501DDT domain
PROSITE profilePS5082716.9610161075IPR018501DDT domain
PfamPF027913.8E-1710181072IPR018501DDT domain
PfamPF050663.6E-1511971265IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156125.3E-614161460IPR028942WHIM1 domain
PfamPF156138.8E-1315991671IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006810Biological Processtransport
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0005215Molecular Functiontransporter activity
Sequence ? help Back to Top
Protein Sequence    Length: 2257 aa     Download sequence    Send to blast
MSDMDRVDLR FCWVMSVIGP TNGEPISYPP AFPTNHGVAS VVTRHRIRTA TLPAQAIPQR  60
KRRRLVRLGP ADRGRERGRE PHMGEAAPPG AAARGVPDKE GDSQTVPRRG LVAGSRRFRR  120
VSDAKVAPIG FFDKYPFILT GFFFFMWYFL NVIFNIMNKK IYNYFPYPYF VSVVHLGVGV  180
VYCLISWAVG LPKRAPIDAN LLKLLIPVAV CHALGHVTSN VSFAAVAVSF THTIKALEPF  240
FNASASQFVL GQSIPLSLWL SLAPVVIGVS MASLTELSFN WLGFISAMIS NISFTYRSIY  300
SKKAMTDMDS TNLYAYISII ALIVCIPPAL ILEGPQLIKY GFNDAIAKVG LVKFVTDLFW  360
VGLFYHLYNQ LATNTLERVA PLTHAVGNVL KRVFVIGFSI VIFGNKISTQ TGIGTAIAIA  420
GVAIYSYLKA KIEEEKRSKP KRQMKTPFQL ETLEKAYALD TYPSEAVRAE LSERLGLSDR  480
QLQMWFCHRR LKDKKEGGPP KKQRKLAPPL PEPPMDDLAH GSEPGSDYGS GSGSGSSPFG  540
HAQLRNVVAR GVADDIPMRG RRYYESPQSK LELRAIACVE AQLGEPLREN GPLLGIEFDP  600
LPPDAFGAPI AQLSNALYLT YVGLDCSIVQ GILCIFLFPA NPFDYLLGEA VAEQQKRSAH  660
ALEGKYERHD AKPNKVCPFF FDKLIIFIHR MMNEFSSQAA PRTLHEYPFL QDHSSIRSDA  720
YGQVSQSHFH DSAIDGPSAR TSSFAVGNEP LSRVHVHGHA SRVRLLSQQE RQAVPYSSPV  780
DDGSVPQRDS FTNVRVNTQF SDPPVVAPEN SNLLSEDQIN DSILRMERKR KSEEVRIAKE  840
VEAHELRIRK ELEKQDILRR KNEERMRKEM ERQDRERRKE EERLMRERQR EEERLKREQK  900
REIERREKFL QKEYIRAEKR RQKEELRKER EVVRRKAALE KATARRLAKE SMELIEDEQL  960
ELMELAAASK GLSSIISIDL DTLQNLDAFR DSLVAFPPRS VQLKRPFAIQ PWINSEANIG  1020
NLLMVWRFLI TFADVLELWP FTLDEFVQAF HDYDSRLLGE IHVALLRLII KDIEDVARTP  1080
TGLGINQNGA ANPGGGHPQI VEGAYAWGFD IRNWQQHLNL LTWPEIFRQL ALSAGFGPQL  1140
KKRSIAWSYT PDKDEGKGCQ DAISNLRNGS AAVNAFAVMQ EKGLLAPRRS RHRLTPGTVK  1200
FAAFHVLSLE GNKGLTVLDL AEKIQKSGLR DLTTSKTPEA SISVALTRDT KLFERIAPST  1260
YRVRAAYRKD PIDAEAVLSA ARKKIQIFEN GILAAEDVDD VERDDVENDE VERDEDFECE  1320
VDEDPEVDDL ATPSVAKKSP DDYSEVIIFS ENGKDSLCGD VGLAVKNEFD KDVLCSPVTG  1380
SKDVFCPSAS SKQCVSGVDI STSNLDQENM EIDESKSGES WVQGLTEGEY SDLSVEERLR  1440
GLVALIGVAN EGNTIRVVLE DRLEAANALK KQMLAEAQLD KSRLKEENVG RLDFPSFMGG  1500
KAEVQATGVE DGQSPLRDVD NRNIEASPVT AENQKSIHGS QGVQNQLNGV PVERTSAAQD  1560
FSMGSDNFLS QQLAYASKRS RSQLKSYIAH RAEEMYAYRS LPLGQDRRHN RYWQFVASAS  1620
RNDPGSGRIF IELNNGSWRL IDTEGAFDAL VTALDTRGIR ESHLRLMLQK IEASFRENGR  1680
KNAHCPNHAG PSKNHVKNEA DEMDSSPDFP SRFDSPESTV CALNSDTTQS SSSFRIELDR  1740
SETEKRAALR RYQDFQKWMW KECFNSSTLC ATKYGKERCR PLFDVCDVCL SCYYFEDSHC  1800
DTCHQTFDAF NGNFDFNEHV IQCKRKRTLE PWDFHIPCTS VPLARRLLKA LIGLVEVCTP  1860
PEALQSVWIE DRRKMWGEKL NASSSMEELL QTLTLFETAV KKDFLSSHFA LTEELLGSCK  1920
QLGVVRDYLD NGSVPVLPWI PLTTAAVALR LHEIDSAITY VKQATPEPTA DKEVGEYLNQ  1980
PMRLLASRSE TELTEAGLNE YTREDNSTHL KSGRNSFRRG RGGREQGRGK RWQKKVNNPK  2040
SVASRRNIRG NENLSQGLRT VGKRTQGQGS GRGRRTVRKR RMKNRAVEGT PLGRMSDIRS  2100
SPESGGESPR NLAEEWDDEK IDMKGDEQGE GYEQGELGEG YEQGELGEGY EQGELGEGYE  2160
QGGALESEDD EQAVGYGQGN WEIGFDGTSS GWNRGLVEAS DNDLDTSEDD NNVMEEVRDE  2220
DSEGDVDVDM SDASDEMPNA MRNDDGTESE SSDDYSE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15963RKRRR
26064KRRRL
3435441KRSKPKR
4488495RRLKDKKE
5894900LKREQKR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.51460.0bud| fruit| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008383691.10.0PREDICTED: uncharacterized protein LOC103446378 isoform X1
SwissprotF4HY560.0RLT1_ARATH; Homeobox-DDT domain protein RLT1
TrEMBLM5X2Q20.0M5X2Q2_PRUPE; Uncharacterized protein
STRINGGLYMA13G30860.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25233369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.10.0homeobox-1